Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOL3 Peptide - middle region

APOL3 Peptide - middle region

Product Specifications

Product Name Alternative

APOLIII, CG121

UniProt

O95236

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APOL3 Rabbit Polyclonal Antibody (orb331354) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_663615

Preservative

Lyophilized powder

AA Sequence

AIEDEYVQQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEVHRGC

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Follistatin-related Gene Protein/FLRG/Fstl3 Antibody [Alexa Fluor 532]
NBP2-98212AF532 0.1 mL

Rabbit Polyclonal Follistatin-related Gene Protein/FLRG/Fstl3 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
GSC2 shRNA (m) Lentiviral Particles
sc-145794-V 200 µL

GSC2 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Mmu-miR-1982-5p inhibitor
HY-RI02801-01 5 nmol

Mmu-miR-1982-5p inhibitor

Sign In for Pricing
View Details
Mmu-miR-1982-5p inhibitor
HY-RI02801-02 20 nmol

Mmu-miR-1982-5p inhibitor

Sign In for Pricing
View Details
Phosphopantetheine Impurity 6
RM-P420006-01 10 mg

Phosphopantetheine Impurity 6

Sign In for Pricing
View Details
Phosphopantetheine Impurity 6
RM-P420006-02 25 mg

Phosphopantetheine Impurity 6

Sign In for Pricing
View Details