Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOL3 Peptide - N-terminal region

APOL3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

APOLIII, CG121

UniProt

O95236

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APOL3 Rabbit Polyclonal Antibody (orb331355) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_663615

Preservative

Lyophilized powder

AA Sequence

DARLEVGSTQLRTAGSCSHSFKRSFLEKKRFTEEATKYFRERVSPVHLQI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SIL1 activation kit by CRISPRa
GA112048 1 Kit

Human SIL1 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Protein Lysate, Lymphoid tissue
CP565506 150 µg

Tissue Protein Lysate, Lymphoid tissue

Sign In for Pricing
View Details
Heptadecanedioic Acid
TRC-H998558-50MG 50 mg

Heptadecanedioic Acid

Sign In for Pricing
View Details
IL26 Rabbit Polyclonal Antibody
TA377462 100 µL

IL26 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CYP27B1 Rabbit Polyclonal Antibody
TA375282 100 µL

CYP27B1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SNX2 (NM_003100) Human Over-expression Lysate
LC401081 20 µg

SNX2 (NM_003100) Human Over-expression Lysate

Sign In for Pricing
View Details