Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOL3 Peptide - N-terminal region

APOL3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

APOLIII, CG121

UniProt

O95236

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APOL3 Rabbit Polyclonal Antibody (orb331355) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_663615

Preservative

Lyophilized powder

AA Sequence

DARLEVGSTQLRTAGSCSHSFKRSFLEKKRFTEEATKYFRERVSPVHLQI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fas activation kit by CRISPRa
GA201356 1 Kit

Mouse Fas activation kit by CRISPRa

Sign In for Pricing
View Details
FHL1 (NM_001449) Human Over-expression Lysate
LC400563 20 µg

FHL1 (NM_001449) Human Over-expression Lysate

Sign In for Pricing
View Details
CYTIP Antibody
KC-7125-01 50 μL

CYTIP Antibody

Sign In for Pricing
View Details
CYTIP Antibody
KC-7125-02 100 µL

CYTIP Antibody

Sign In for Pricing
View Details
CYTIP Antibody
KC-7125-03 1 mL

CYTIP Antibody

Sign In for Pricing
View Details
RPL39 (Center) Rabbit Polyclonal Antibody
AP53721PU-N 400 µL

RPL39 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details