Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP63 Peptide - N-terminal region

CEP63 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ13386, MGC78416

UniProt

Q96MT8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEP63 Rabbit Polyclonal Antibody (orb586591) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079456

Preservative

Lyophilized powder

AA Sequence

YEKLQKKQMREFRGNTKNHREDRSEIERLTAKIEEFRQKSLDWEKQRLIY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adamts4 Mouse Gene Knockout Kit (CRISPR)
KN500861 1 Kit

Adamts4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD56 / NCAM (123C3.D5), 0.2mg/mL
BNUB0015-500 1x 500 µL

CD56 / NCAM (123C3.D5), 0.2mg/mL

Sign In for Pricing
View Details
(3-((2-(Aziridin-1-yl)ethyl)amino)propyl)phosphonic Acid
TRC-A408330-25MG 25 mg

(3-((2-(Aziridin-1-yl)ethyl)amino)propyl)phosphonic Acid

Sign In for Pricing
View Details
L-Serine-15N
TRC-S271070-10MG 10 mg

L-Serine-15N

Sign In for Pricing
View Details
ZFR Human Gene Knockout Kit (CRISPR)
KN419016 1 Kit

ZFR Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Automation Reservoirs
RES16SW-3-NS-IW 10 Plates/Pack

Automation Reservoirs

Sign In for Pricing
View Details