Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP63 Peptide - N-terminal region

CEP63 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ13386, MGC78416

UniProt

Q96MT8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEP63 Rabbit Polyclonal Antibody (orb586591) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079456

Preservative

Lyophilized powder

AA Sequence

YEKLQKKQMREFRGNTKNHREDRSEIERLTAKIEEFRQKSLDWEKQRLIY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNAR1 Recombinant Rabbit monoclonal Antibody
HA750046 100 µL

IFNAR1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Opn1mw (OPN1MW2) (NM_001048181) Human Over-expression Lysate
LY420772 100 µg

Opn1mw (OPN1MW2) (NM_001048181) Human Over-expression Lysate

Sign In for Pricing
View Details
Protein A  Colloidal Gold, 1mL 40nm
GP-01-40 1 mL

Protein A Colloidal Gold, 1mL 40nm

Sign In for Pricing
View Details
DPP8 (NM_130434) Human Over-expression Lysate
LY403323 100 µg

DPP8 (NM_130434) Human Over-expression Lysate

Sign In for Pricing
View Details
Human KIF15 activation kit by CRISPRa
GA111323 1 Kit

Human KIF15 activation kit by CRISPRa

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human Immunoglobulins,  30nm
GAF-006-30 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human Immunoglobulins, 30nm

Sign In for Pricing
View Details