Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX6B1 Peptide - N-terminal region

COX6B1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

COX6B, COXG, COXVIb1

UniProt

P14854

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COX6B1 Rabbit Polyclonal Antibody (orb586597) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001854

Preservative

Lyophilized powder

AA Sequence

TAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse STK39 siRNA
abx935488-01 15 nmol

Mouse STK39 siRNA

Sign In for Pricing
View Details
Mouse STK39 siRNA
abx935488-02 30 nmol

Mouse STK39 siRNA

Sign In for Pricing
View Details
Fpgs sgRNA CRISPR Lentivector set (Rat)
K7513601 3x 1.0 µg

Fpgs sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Guinea pig Dendritic cell Associated C type Lectin 1 ELISA Kit
MBS734996-01 48 Well

Guinea pig Dendritic cell Associated C type Lectin 1 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Dendritic cell Associated C type Lectin 1 ELISA Kit
MBS734996-02 96 Well

Guinea pig Dendritic cell Associated C type Lectin 1 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Dendritic cell Associated C type Lectin 1 ELISA Kit
MBS734996-03 5x 96 Well

Guinea pig Dendritic cell Associated C type Lectin 1 ELISA Kit

Sign In for Pricing
View Details