Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX6B1 Peptide - N-terminal region

COX6B1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

COX6B, COXG, COXVIb1

UniProt

P14854

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COX6B1 Rabbit Polyclonal Antibody (orb586597) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001854

Preservative

Lyophilized powder

AA Sequence

TAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human/Mouse/Rat BMP-2 Quantikine ELISA Kit
DBP200 96 Tests

Human/Mouse/Rat BMP-2 Quantikine ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal LAMTOR1 Antibody [Alexa Fluor 700]
NBP2-82075AF700 0.1 mL

Rabbit Polyclonal LAMTOR1 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
C19orf36 sgRNA CRISPR Lentivector (Human) (Target 1)
K0328302 1.0 µg DNA

C19orf36 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
GBX1, ID (GBX1, Homeobox protein GBX-1, Gastrulation and brain-specific homeobox protein 1) (Biotin) discontinued
035946-Biotin 200 µL

GBX1, ID (GBX1, Homeobox protein GBX-1, Gastrulation and brain-specific homeobox protein 1) (Biotin) discontinued

Sign In for Pricing
View Details
ASZ1 Polyclonal Antibody, Cy5 Conjugated
bs-9325R-Cy5 100 µL

ASZ1 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
1,5-Dimethyl Citrate
010356-01 1 g

1,5-Dimethyl Citrate

Sign In for Pricing
View Details