Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEM1 Peptide - C-terminal region

DEM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C1orf176, FLJ11445, FLJ13183, FLJ21144, Exo V, DEM1

UniProt

Q9H790

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DEM1 Rabbit Polyclonal Antibody (orb586604) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_073611

Preservative

Lyophilized powder

AA Sequence

RPMLPLEAQKKKDCFQVSLYKYIFDAMVQGKVTPASLIHHTKLCLEKPLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant MCM4 Antibody
RC-16191-01 50 μL

Recombinant MCM4 Antibody

Sign In for Pricing
View Details
Recombinant MCM4 Antibody
RC-16191-02 100 µL

Recombinant MCM4 Antibody

Sign In for Pricing
View Details
Recombinant MCM4 Antibody
RC-16191-03 1 mL

Recombinant MCM4 Antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD14 Antibody[Sa14-2]
E-AB-F1176H-01 50 Tests

PE/Cyanine7 Anti-Mouse CD14 Antibody[Sa14-2]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD14 Antibody[Sa14-2]
E-AB-F1176H-02 100 Tests

PE/Cyanine7 Anti-Mouse CD14 Antibody[Sa14-2]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD14 Antibody[Sa14-2]
E-AB-F1176H-03 2x 100 Tests

PE/Cyanine7 Anti-Mouse CD14 Antibody[Sa14-2]

Sign In for Pricing
View Details