Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEM1 Peptide - C-terminal region

DEM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C1orf176, FLJ11445, FLJ13183, FLJ21144, Exo V, DEM1

UniProt

Q9H790

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DEM1 Rabbit Polyclonal Antibody (orb586604) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_073611

Preservative

Lyophilized powder

AA Sequence

RPMLPLEAQKKKDCFQVSLYKYIFDAMVQGKVTPASLIHHTKLCLEKPLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Amino-5-nitrophenol
TRC-A580130-50G 50 g

2-Amino-5-nitrophenol

Sign In for Pricing
View Details
TBKBP1 (NM_014726) Human Recombinant Protein
TP323867L 1 mg

TBKBP1 (NM_014726) Human Recombinant Protein

Sign In for Pricing
View Details
Tyrosine Hydroxylase (TH) Rabbit Polyclonal Antibody
AP06358PU-N 100 µg

Tyrosine Hydroxylase (TH) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FANCD2 Rabbit Polyclonal Antibody
AP06115PU-N 100 µg

FANCD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human GM-CSF/CSF2 Protein (E.coli)
PKSH033662-01 20 µg

Recombinant Human GM-CSF/CSF2 Protein (E.coli)

Sign In for Pricing
View Details
Recombinant Human GM-CSF/CSF2 Protein (E.coli)
PKSH033662-02 100 µg

Recombinant Human GM-CSF/CSF2 Protein (E.coli)

Sign In for Pricing
View Details