Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4E1B Peptide - N-terminal region

EIF4E1B Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ36951

UniProt

A6NMX2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF4E1B Rabbit Polyclonal Antibody (orb326614) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001092878

Preservative

Lyophilized powder

AA Sequence

EKEEEAAERTPTGEKSPNSPRTLLSLRGKARTGGPMEVKLELHPLQNRWA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cabozantinib-d4 (FluoroBenzene-d4)
CS-EO-01503 1 Each

Cabozantinib-d4 (FluoroBenzene-d4)

Sign In for Pricing
View Details
PRPSAP1 discontinued
531485-01 20 µL

PRPSAP1 discontinued

Sign In for Pricing
View Details
PRPSAP1 discontinued
531485-02 100 µL

PRPSAP1 discontinued

Sign In for Pricing
View Details
CD48 Mouse Monoclonal Antibody
orb2988655-01 30 µL

CD48 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD48 Mouse Monoclonal Antibody
orb2988655-02 50 µL

CD48 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD48 Mouse Monoclonal Antibody
orb2988655-03 100 µL

CD48 Mouse Monoclonal Antibody

Sign In for Pricing
View Details