Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4E1B Peptide - N-terminal region

EIF4E1B Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ36951

UniProt

A6NMX2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF4E1B Rabbit Polyclonal Antibody (orb326614) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001092878

Preservative

Lyophilized powder

AA Sequence

EKEEEAAERTPTGEKSPNSPRTLLSLRGKARTGGPMEVKLELHPLQNRWA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Neural cell adhesion molecule 1 (Ncam1)
MBS961624-01 0.02 mg (Yeast)

Recombinant Rat Neural cell adhesion molecule 1 (Ncam1)

Sign In for Pricing
View Details
Recombinant Rat Neural cell adhesion molecule 1 (Ncam1)
MBS961624-02 0.1 mg (Yeast)

Recombinant Rat Neural cell adhesion molecule 1 (Ncam1)

Sign In for Pricing
View Details
Recombinant Rat Neural cell adhesion molecule 1 (Ncam1)
MBS961624-03 1 mg (Yeast)

Recombinant Rat Neural cell adhesion molecule 1 (Ncam1)

Sign In for Pricing
View Details
Recombinant Rat Neural cell adhesion molecule 1 (Ncam1)
MBS961624-04 5x 1 mg (Yeast)

Recombinant Rat Neural cell adhesion molecule 1 (Ncam1)

Sign In for Pricing
View Details
RAB17 Antibody
orb2673370-01 50 µL

RAB17 Antibody

Sign In for Pricing
View Details
RAB17 Antibody
orb2673370-02 100 µL

RAB17 Antibody

Sign In for Pricing
View Details