Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FEZ2 Peptide - C-terminal region

FEZ2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HUM3CL, MGC117372

UniProt

Q9UHY8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FEZ2 Rabbit Polyclonal Antibody (orb586606) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005093

Preservative

Lyophilized powder

AA Sequence

IEVQNKQKEHKETAKKKKKLKNGSSQNGKNERSHMPGTYLTTVIPYEKKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (1H-Indol-3-yl) butan-1-ol
PDA22991-01 50 mg

3- (1H-Indol-3-yl) butan-1-ol

Sign In for Pricing
View Details
3- (1H-Indol-3-yl) butan-1-ol
PDA22991-02 0.5 g

3- (1H-Indol-3-yl) butan-1-ol

Sign In for Pricing
View Details
DCAF15 Human siRNA Oligo Duplex (Locus ID 90379)
SR313992 1 Kit

DCAF15 Human siRNA Oligo Duplex (Locus ID 90379)

Sign In for Pricing
View Details
Human ZNF382 knockout cell line
ABC-KH17509 1 Vial

Human ZNF382 knockout cell line

Sign In for Pricing
View Details
MSH6 Antibody
orb2642855 7 mL

MSH6 Antibody

Sign In for Pricing
View Details
5-Nitro-2-pyrrolidin-1-ylbenzonitrile
sc-318982 500 mg

5-Nitro-2-pyrrolidin-1-ylbenzonitrile

Sign In for Pricing
View Details