Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FEZ2 Peptide - C-terminal region

FEZ2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HUM3CL, MGC117372

UniProt

Q9UHY8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FEZ2 Rabbit Polyclonal Antibody (orb586606) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005093

Preservative

Lyophilized powder

AA Sequence

IEVQNKQKEHKETAKKKKKLKNGSSQNGKNERSHMPGTYLTTVIPYEKKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SETBP1 Polyclonal Antibody
A72209-100 100 µL

SETBP1 Polyclonal Antibody

Sign In for Pricing
View Details
Hi-PCR® Coronavirus (COVID-19) Multiplex Probe PCR Kit
MBPCR243-25R 25 Reaction

Hi-PCR® Coronavirus (COVID-19) Multiplex Probe PCR Kit

Sign In for Pricing
View Details
4-O-ß-Galactopyranosyl-D-mannopyranoside (Epilactose, Lactulose impurity A)
G1021-21-01 10 mg

4-O-ß-Galactopyranosyl-D-mannopyranoside (Epilactose, Lactulose impurity A)

Sign In for Pricing
View Details
4-O-ß-Galactopyranosyl-D-mannopyranoside (Epilactose, Lactulose impurity A)
G1021-21-02 100 mg

4-O-ß-Galactopyranosyl-D-mannopyranoside (Epilactose, Lactulose impurity A)

Sign In for Pricing
View Details
SORL1 Antibody
MBS850606-01 0.1 mg

SORL1 Antibody

Sign In for Pricing
View Details
SORL1 Antibody
MBS850606-02 0.1 mL (AF405L)

SORL1 Antibody

Sign In for Pricing
View Details