Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FEZ2 Peptide - C-terminal region

FEZ2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HUM3CL, MGC117372

UniProt

Q9UHY8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FEZ2 Rabbit Polyclonal Antibody (orb586606) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005093

Preservative

Lyophilized powder

AA Sequence

IEVQNKQKEHKETAKKKKKLKNGSSQNGKNERSHMPGTYLTTVIPYEKKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLACC1 Human siRNA Oligo Duplex (Locus ID 130540)
SR315099 1 Kit

FLACC1 Human siRNA Oligo Duplex (Locus ID 130540)

Sign In for Pricing
View Details
Recombinant Xanthomonas campestris pv. campestris Protein translocase subunit SecA (secA), partial
MBS1484638 Inquire

Recombinant Xanthomonas campestris pv. campestris Protein translocase subunit SecA (secA), partial

Sign In for Pricing
View Details
Anti-Rabbit Immunoglobulin Antibody
14601-500 500ug

Anti-Rabbit Immunoglobulin Antibody

Sign In for Pricing
View Details
Goat Anti Human IgG Fab-AbFluor 790
SA1087-01 100 µL

Goat Anti Human IgG Fab-AbFluor 790

Sign In for Pricing
View Details
Goat Anti Human IgG Fab-AbFluor 790
SA1087-02 1 mL

Goat Anti Human IgG Fab-AbFluor 790

Sign In for Pricing
View Details
S100a9 Polyclonal Antibody, Biotin Conjugated
A55442-050 50 µL

S100a9 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details