Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAUS3 Peptide - middle region

HAUS3 Peptide - middle region

Product Specifications

Product Name Alternative

C4orf15, DKFZp686I1868, IT1, MGC4701, dgt3

UniProt

Q68CZ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HAUS3 Rabbit Polyclonal Antibody (orb586610) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078787

Preservative

Lyophilized powder

AA Sequence

KWAEESLHSLTSKAVDKENLDAKISSLTSEIMKLEKEVTQIKDRSLPAVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KV125 Rabbit Polyclonal Antibody
BT-AP10949-01 20 µL

KV125 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KV125 Rabbit Polyclonal Antibody
BT-AP10949-02 50 µL

KV125 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KV125 Rabbit Polyclonal Antibody
BT-AP10949-03 100 µL

KV125 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HEY2 sgRNA CRISPR Lentivector set (Human)
K0948301 3x 1.0 µg

HEY2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Pdi1p
MO22181 500 µL

Pdi1p

Sign In for Pricing
View Details
ARFIP1 Antibody
E94651 100 µg

ARFIP1 Antibody

Sign In for Pricing
View Details