Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAUS3 Peptide - middle region

HAUS3 Peptide - middle region

Product Specifications

Product Name Alternative

C4orf15, DKFZp686I1868, IT1, MGC4701, dgt3

UniProt

Q68CZ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HAUS3 Rabbit Polyclonal Antibody (orb586610) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078787

Preservative

Lyophilized powder

AA Sequence

KWAEESLHSLTSKAVDKENLDAKISSLTSEIMKLEKEVTQIKDRSLPAVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 Antibody
MBS153431-01 0.1 mg

CD59 Antibody

Sign In for Pricing
View Details
CD59 Antibody
MBS153431-02 5x 0.1 mg

CD59 Antibody

Sign In for Pricing
View Details
Creld1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
16822116 3x 1.0 µg

Creld1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
C9orf96 (STKLD1) CytoSection
TS407330P5 25 Slides

C9orf96 (STKLD1) CytoSection

Sign In for Pricing
View Details
Properdin (Factor P, CFP, PFC) (Biotin)
227130-Biotin 100 µL

Properdin (Factor P, CFP, PFC) (Biotin)

Sign In for Pricing
View Details
Cytoplasmic dynein 1 light intermediate chain 1 (DYNC1LI1) (NM_016141) Human Over-expression Lysate
LS051143 100 µg

Cytoplasmic dynein 1 light intermediate chain 1 (DYNC1LI1) (NM_016141) Human Over-expression Lysate

Sign In for Pricing
View Details