Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAUS3 Peptide - N-terminal region

HAUS3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C4orf15, DKFZp686I1868, IT1, MGC4701, dgt3

UniProt

Q68CZ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HAUS3 Rabbit Polyclonal Antibody (orb586611) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078787

Preservative

Lyophilized powder

AA Sequence

NAKEEEATKKLKQSQGILNAMITKISNELQALTDEVTQLMMFFRHSNLGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Islr Mouse Gene Knockout Kit (CRISPR)
KN308455 1 Kit

Islr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1997R), CF647 conjugate, 0.1mg/mL
BNC471997-500 1x 500 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1997R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calcineurin A / PPP3CA (BF1.1), CF488A conjugate, 0.1mg/mL
BNC882283-500 1x 500 µL

Calcineurin A / PPP3CA (BF1.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cmtm5 (BC049665) Mouse Tagged ORF Clone
MG201167 10 µg

Cmtm5 (BC049665) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human RTEL1 activation kit by CRISPRa
GA109973 1 Kit

Human RTEL1 activation kit by CRISPRa

Sign In for Pricing
View Details
Kv1.2 (KCNA2) Rabbit Polyclonal Antibody
TA361509 100 µL

Kv1.2 (KCNA2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details