Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAUS3 Peptide - N-terminal region

HAUS3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C4orf15, DKFZp686I1868, IT1, MGC4701, dgt3

UniProt

Q68CZ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HAUS3 Rabbit Polyclonal Antibody (orb586611) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078787

Preservative

Lyophilized powder

AA Sequence

NAKEEEATKKLKQSQGILNAMITKISNELQALTDEVTQLMMFFRHSNLGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DTX2 Antibody
KC-2262-01 50 μL

DTX2 Antibody

Sign In for Pricing
View Details
DTX2 Antibody
KC-2262-02 100 µL

DTX2 Antibody

Sign In for Pricing
View Details
DTX2 Antibody
KC-2262-03 1 mL

DTX2 Antibody

Sign In for Pricing
View Details
ATG5 (Autophagy Marker) (ATG5/2101), CF488A conjugate, 0.1mg/mL
BNC882101-500 1x 500 µL

ATG5 (Autophagy Marker) (ATG5/2101), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Diphenyldiethyltin-d10
TRC-D487602-10MG 10 mg

Diphenyldiethyltin-d10

Sign In for Pricing
View Details
26-Deoxymonensin A Sodium Salt
TRC-D243000-10MG 10 mg

26-Deoxymonensin A Sodium Salt

Sign In for Pricing
View Details