HSPB11 Peptide - N-terminal region
HSPB11 Peptide - N-terminal region
Product Specifications
Product Name Alternative
C1orf41, HSPCO34, PP25, IFT25
UniProt
Q9Y547
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HSPB11 Rabbit Polyclonal Antibody (orb326617) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057210
Preservative
Lyophilized powder
AA Sequence
LCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY400062 100 µg
alpha 1 Glycine Receptor (GLRA1) (NM_000171) Human Over-expression Lysate
Sign In for Pricing
View Details 
![Human Lambda Light Chain Mouse Monoclonal Antibody [Clone ID: HP6054]](https://cdn.genprice.uk/products/937/68dd189e061270361e8fd3a4/imageurl/am32827pu-t.webp)
AM32827PU-T 20 µg
Human Lambda Light Chain Mouse Monoclonal Antibody [Clone ID: HP6054]
Sign In for Pricing
View Details 
