Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPB11 Peptide - N-terminal region

HSPB11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C1orf41, HSPCO34, PP25, IFT25

UniProt

Q9Y547

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSPB11 Rabbit Polyclonal Antibody (orb326617) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057210

Preservative

Lyophilized powder

AA Sequence

LCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TEX30 activation kit by CRISPRa
GA114260 1 Kit

Human TEX30 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS705568 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
GBP4 Polyclonal Antibody
E-AB-19901-01 20 µL

GBP4 Polyclonal Antibody

Sign In for Pricing
View Details
GBP4 Polyclonal Antibody
E-AB-19901-02 60 µL

GBP4 Polyclonal Antibody

Sign In for Pricing
View Details
GBP4 Polyclonal Antibody
E-AB-19901-03 120 µL

GBP4 Polyclonal Antibody

Sign In for Pricing
View Details
GBP4 Polyclonal Antibody
E-AB-19901-04 200 µL

GBP4 Polyclonal Antibody

Sign In for Pricing
View Details