Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFL1 Peptide - C-terminal region

IGFL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

UNQ644

UniProt

Q6UW32

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IGFL1 Rabbit Polyclonal Antibody (orb586613) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_940943

Preservative

Lyophilized powder

AA Sequence

AVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCR2 Blocking Peptide
33R-10752 50 ug

CCR2 Blocking Peptide

Sign In for Pricing
View Details
HuR Antibody
F40262-0.08ML 0.08 mL

HuR Antibody

Sign In for Pricing
View Details
Chloroformic Acid Chloromethyl Ester
163066 1 g

Chloroformic Acid Chloromethyl Ester

Sign In for Pricing
View Details
APC-Cy7 Linked Monoclonal Antibody to Carcinoembryonic Antigen (CEA)
MBS2116764-01 0.1 mL

APC-Cy7 Linked Monoclonal Antibody to Carcinoembryonic Antigen (CEA)

Sign In for Pricing
View Details
APC-Cy7 Linked Monoclonal Antibody to Carcinoembryonic Antigen (CEA)
MBS2116764-02 0.2 mL

APC-Cy7 Linked Monoclonal Antibody to Carcinoembryonic Antigen (CEA)

Sign In for Pricing
View Details
APC-Cy7 Linked Monoclonal Antibody to Carcinoembryonic Antigen (CEA)
MBS2116764-03 0.5 mL

APC-Cy7 Linked Monoclonal Antibody to Carcinoembryonic Antigen (CEA)

Sign In for Pricing
View Details