Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFL1 Peptide - C-terminal region

IGFL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

UNQ644

UniProt

Q6UW32

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IGFL1 Rabbit Polyclonal Antibody (orb586613) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_940943

Preservative

Lyophilized powder

AA Sequence

AVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CATSPER Rabbit Polyclonal Antibody
orb704210-01 50 μL

CATSPER Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CATSPER Rabbit Polyclonal Antibody
orb704210-02 100 µL

CATSPER Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CATSPER Rabbit Polyclonal Antibody
orb704210-03 200 µL

CATSPER Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Iroquois-class homeodomain protein IRX-5 Antibody [mFluor Violet 450 SE]
NBP3-21441MFV450 0.1 mL

Rabbit Polyclonal Iroquois-class homeodomain protein IRX-5 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Rabbit Monoclonal ILT5/CD85a/LILRB3 Antibody (058) [DyLight 680]
NBP2-90707FR 0.1 mL

Rabbit Monoclonal ILT5/CD85a/LILRB3 Antibody (058) [DyLight 680]

Sign In for Pricing
View Details
KCNJ12 Antibody
CSB-PA012050GA01HU 100 µL

KCNJ12 Antibody

Sign In for Pricing
View Details