Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INPP5A Peptide - C-terminal region

INPP5A Peptide - C-terminal region

Product Specifications

Product Name Alternative

5PTASE, DKFZp434A1721, MGC116947, MGC116949

UniProt

Q14642

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INPP5A Rabbit Polyclonal Antibody (orb586615) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005530

Preservative

Lyophilized powder

AA Sequence

VVKLIFRESDNDRKVMLQLEKKLFDYFNQEVFRDNNGTALLEFDKELSVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse 8-Hydroxy-desoxyguanosine, 8-OHdG ELISA Kit
MBS700097-01 24 Well (LIMIT 1)

Mouse 8-Hydroxy-desoxyguanosine, 8-OHdG ELISA Kit

Sign In for Pricing
View Details
Mouse 8-Hydroxy-desoxyguanosine, 8-OHdG ELISA Kit
MBS700097-02 48 Well

Mouse 8-Hydroxy-desoxyguanosine, 8-OHdG ELISA Kit

Sign In for Pricing
View Details
Mouse 8-Hydroxy-desoxyguanosine, 8-OHdG ELISA Kit
MBS700097-03 96 Well

Mouse 8-Hydroxy-desoxyguanosine, 8-OHdG ELISA Kit

Sign In for Pricing
View Details
Mouse 8-Hydroxy-desoxyguanosine, 8-OHdG ELISA Kit
MBS700097-04 5x 96 Well

Mouse 8-Hydroxy-desoxyguanosine, 8-OHdG ELISA Kit

Sign In for Pricing
View Details
Mouse 8-Hydroxy-desoxyguanosine, 8-OHdG ELISA Kit
MBS700097-05 10x 96 Well

Mouse 8-Hydroxy-desoxyguanosine, 8-OHdG ELISA Kit

Sign In for Pricing
View Details
RAG2 (V (D) J Recombination-activating Protein 2, RAG-2)
132276 50 µg

RAG2 (V (D) J Recombination-activating Protein 2, RAG-2)

Sign In for Pricing
View Details