Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IYD Peptide - N-terminal region

IYD Peptide - N-terminal region

Product Specifications

Product Name Alternative

C6orf71, DEHAL1, TDH4, dJ422F24.1

UniProt

Q6PHW0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IYD Rabbit Polyclonal Antibody (orb586616) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001158167

Preservative

Lyophilized powder

AA Sequence

NADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[Sar1, Thr8]-Angiotensin II
MBS8202823-01 5 mg

[Sar1, Thr8]-Angiotensin II

Sign In for Pricing
View Details
[Sar1, Thr8]-Angiotensin II
MBS8202823-02 10 mg

[Sar1, Thr8]-Angiotensin II

Sign In for Pricing
View Details
[Sar1, Thr8]-Angiotensin II
MBS8202823-03 25 mg

[Sar1, Thr8]-Angiotensin II

Sign In for Pricing
View Details
[Sar1, Thr8]-Angiotensin II
MBS8202823-04 5x 25 mg

[Sar1, Thr8]-Angiotensin II

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Thrombomodulin (TM)
MBS2043435-01 0.1 mL

PE-Linked Polyclonal Antibody to Thrombomodulin (TM)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Thrombomodulin (TM)
MBS2043435-02 0.2 mL

PE-Linked Polyclonal Antibody to Thrombomodulin (TM)

Sign In for Pricing
View Details