LILRA5 Peptide - N-terminal region
LILRA5 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CD85, CD85F, ILT11, LILRB7, LIR9
UniProt
A6NI73
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LILRA5 Rabbit Polyclonal Antibody (orb586619) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_870994
Preservative
Lyophilized powder
AA Sequence
GNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MTW0F4-MB 50x 96 Well Plates
Medium Binding 96 well plates - 8 Well Strips on 12 x 8 frame - White PS
Sign In for Pricing
View Details 
BNC742884-100 1x 100 µL
CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 