Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRA5 Peptide - N-terminal region

LILRA5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD85, CD85F, ILT11, LILRB7, LIR9

UniProt

A6NI73

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LILRA5 Rabbit Polyclonal Antibody (orb586619) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_870994

Preservative

Lyophilized powder

AA Sequence

GNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD68 (Macrophage Marker) (C68/2501), Biotin conjugate, 0.1mg/mL
BNCB2501-100 1x 100 µL

CD68 (Macrophage Marker) (C68/2501), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calcium Acetate
TRC-C144900-25G 25 g

Calcium Acetate

Sign In for Pricing
View Details
1-[4-(2-hydroxypropan-2-yl)phenyl]ethan-1-one
TRC-B447650-50MG 50 mg

1-[4-(2-hydroxypropan-2-yl)phenyl]ethan-1-one

Sign In for Pricing
View Details
Ccdc169 Mouse Gene Knockout Kit (CRISPR)
KN502682 1 Kit

Ccdc169 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09852P-01 20 Tests

PE/Elab Fluor® 594 Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09852P-02 100 Tests

PE/Elab Fluor® 594 Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details