Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC10 Peptide - C-terminal region

LRRC10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HRLRRP, LRRC10A, MGC125812

UniProt

Q5BKY1

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC10 Rabbit Polyclonal Antibody (orb586623) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_963844

Preservative

Lyophilized powder

AA Sequence

PKVAKGVRRVGRWAEETPEPDPRKARRYALVREESQELQAPVPLLPPTNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transcription factor SOX-30 (SOX30) Antibody (FITC)
abx344556-01 20 µg

Transcription factor SOX-30 (SOX30) Antibody (FITC)

Sign In for Pricing
View Details
Transcription factor SOX-30 (SOX30) Antibody (FITC)
abx344556-02 50 µg

Transcription factor SOX-30 (SOX30) Antibody (FITC)

Sign In for Pricing
View Details
Transcription factor SOX-30 (SOX30) Antibody (FITC)
abx344556-03 100 µg

Transcription factor SOX-30 (SOX30) Antibody (FITC)

Sign In for Pricing
View Details
Transcription factor SOX-30 (SOX30) Antibody (FITC)
abx344556-04 200 µg

Transcription factor SOX-30 (SOX30) Antibody (FITC)

Sign In for Pricing
View Details
Transcription factor SOX-30 (SOX30) Antibody (FITC)
abx344556-05 1 mg

Transcription factor SOX-30 (SOX30) Antibody (FITC)

Sign In for Pricing
View Details
CNTN4 Conjugated Antibody
C34618 100 µL

CNTN4 Conjugated Antibody

Sign In for Pricing
View Details