Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LSM5 Peptide - middle region

LSM5 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ12710, YER146W

UniProt

Q9Y4Y9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LSM5 Rabbit Polyclonal Antibody (orb586625) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036454

Preservative

Lyophilized powder

AA Sequence

GFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CGGBP1 Antibody, Rabbit Polyclonal
MBS8108325-01 0.1 mL

Anti-CGGBP1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-CGGBP1 Antibody, Rabbit Polyclonal
MBS8108325-02 5x 0.1 mL

Anti-CGGBP1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Angiopoietin like 4 (ANGPTL4) Human Gene Knockout Kit (CRISPR)
KN205651 1 Kit

Angiopoietin like 4 (ANGPTL4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Cyclohexyl-3-oxo-2,3-dihydro-1H-pyrrolo-[3,4-b]quinoline-9-carboxylic acid
sc-307815 500 mg

2-Cyclohexyl-3-oxo-2,3-dihydro-1H-pyrrolo-[3,4-b]quinoline-9-carboxylic acid

Sign In for Pricing
View Details
Goat Vitamin B12,VB12 ELISA KIT
JOT-EKA0009GO 96 wells

Goat Vitamin B12,VB12 ELISA KIT

Sign In for Pricing
View Details
Recombinant Human Lymphotactin
BL10500_R 0.025 mg

Recombinant Human Lymphotactin

Sign In for Pricing
View Details