LSM5 Peptide - middle region
LSM5 Peptide - middle region
Product Specifications
Product Name Alternative
FLJ12710, YER146W
UniProt
Q9Y4Y9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LSM5 Rabbit Polyclonal Antibody (orb586625) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_036454
Preservative
Lyophilized powder
AA Sequence
GFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
911612 1 Piece (1 Panel (s) x 1 Pack)
NL7527A4RD-2 Die-cut & Printed Numbers & Letters
Sign In for Pricing
View Details 
orb3079174 100 µg
Serum Amyloid P/APCS Rabbit Polyclonal Antibody (Fluoro488)
Sign In for Pricing
View Details 
C2549-22R1 25 µg
CD274, Mouse IgG2a Fc Fusion Protein (CD274 Molecule, B7 Homolog 1, B7H1, B7-H1, B7-H, Programmed Cell Death 1 Ligand 1, PDCD1 Ligand 1, PDCD1L1, PDCD1LG1, Programmed Death Ligand 1, PDL1, PD-L1)
Sign In for Pricing
View Details 207767-AP 100 µL
LMTK3 (Lemur Tyrosine Kinase 3, KIAA1883, LMR3, TYKLM3) (AP) discontinued
Sign In for Pricing
View Details