Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LY6G6D Peptide - N-terminal region

LY6G6D Peptide - N-terminal region

Product Specifications

Product Name Alternative

C6orf23, G6D, LY6-D, MEGT1, MGC150334, NG25

UniProt

O95868

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LY6G6D Rabbit Polyclonal Antibody (orb326618) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067069

Preservative

Lyophilized powder

AA Sequence

LGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tropolone
TRC-T892705-50G 50 g

Tropolone

Sign In for Pricing
View Details
RBM35A (ESRP1) Rabbit Polyclonal Antibody
TA368637 100 µL

RBM35A (ESRP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Strept. Avidin Colloidal Gold, 1mL 40nm
GA-02-40 1 mL

Strept. Avidin Colloidal Gold, 1mL 40nm

Sign In for Pricing
View Details
Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/2403), CF488A conjugate, 0.1mg/mL
BNC882403-100 1x 100 µL

Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/2403), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ARRDC2 (NM_001025604) Human Over-expression Lysate
LC422456 20 µg

ARRDC2 (NM_001025604) Human Over-expression Lysate

Sign In for Pricing
View Details
4'-Hydroxyflavanone
TRC-H942443-25MG 25 mg

4'-Hydroxyflavanone

Sign In for Pricing
View Details