Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LY6G6D Peptide - N-terminal region

LY6G6D Peptide - N-terminal region

Product Specifications

Product Name Alternative

C6orf23, G6D, LY6-D, MEGT1, MGC150334, NG25

UniProt

O95868

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LY6G6D Rabbit Polyclonal Antibody (orb326618) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067069

Preservative

Lyophilized powder

AA Sequence

LGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TrkA Rabbit Polyclonal Antibody
ER1706-86 100 µL

TrkA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Boc-Lys(Boc)-OSu
TRC-B657060-25G 25 g

Boc-Lys(Boc)-OSu

Sign In for Pricing
View Details
p75 NGF Receptor (NGFR) Mouse Monoclonal Antibody [Clone ID: OTI3B10]
CF812998 100 µg

p75 NGF Receptor (NGFR) Mouse Monoclonal Antibody [Clone ID: OTI3B10]

Sign In for Pricing
View Details
Tissue FFPE Sections, Fallopian tube
CS700432 5x 5 µm

Tissue FFPE Sections, Fallopian tube

Sign In for Pricing
View Details
Lamin B Receptor (LBR) (NM_002296) Human Over-expression Lysate
LY419408 100 µg

Lamin B Receptor (LBR) (NM_002296) Human Over-expression Lysate

Sign In for Pricing
View Details
D-Ribopyranosylamine
TRC-R416850-2.5G 2.5 g

D-Ribopyranosylamine

Sign In for Pricing
View Details