NDUFB4 Peptide - C-terminal region
NDUFB4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
B15, CI-B15, MGC5105
UniProt
O95168
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NDUFB4 Rabbit Polyclonal Antibody (orb586630) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004538
Preservative
Lyophilized powder
AA Sequence
ARTINVYPNFRPTPKNSLMGALCGFGPLIFIYYIIKTERDRKEKLIQEGK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RDR-CDC25-Mu-01 96 Tests
Mouse Cell Division Cycle Protein 25 (CDC25) ELISA Kit
Sign In for Pricing
View Details RDR-CDC25-Mu-02 48 Tests
Mouse Cell Division Cycle Protein 25 (CDC25) ELISA Kit
Sign In for Pricing
View Details 
BNC883496-100 1x 100 µL
PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3496), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details