Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFB4 Peptide - C-terminal region

NDUFB4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

B15, CI-B15, MGC5105

UniProt

O95168

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFB4 Rabbit Polyclonal Antibody (orb586630) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004538

Preservative

Lyophilized powder

AA Sequence

ARTINVYPNFRPTPKNSLMGALCGFGPLIFIYYIIKTERDRKEKLIQEGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGLON5 (NM_001101372) Human Recombinant Protein
TP325495L 1 mg

IGLON5 (NM_001101372) Human Recombinant Protein

Sign In for Pricing
View Details
Synaptogyrin 2 (SYNGR2) Human Gene Knockout Kit (CRISPR)
KN401819 1 Kit

Synaptogyrin 2 (SYNGR2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MAP126 (SPAG5) Human Gene Knockout Kit (CRISPR)
KN201783LP 1 Kit

MAP126 (SPAG5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Card6 Mouse Gene Knockout Kit (CRISPR)
KN502544 1 Kit

Card6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
o-Isopropylaniline
TRC-I824170-50G 50 g

o-Isopropylaniline

Sign In for Pricing
View Details
Rabbit Cholecystokinin A Receptor (CCKAR) ELISA Kit
RDR-CCKAR-Rb-01 96 Tests

Rabbit Cholecystokinin A Receptor (CCKAR) ELISA Kit

Sign In for Pricing
View Details