PAAF1 Peptide - N-terminal region
PAAF1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FLJ11848, PAAF, Rpn14, WDR71
UniProt
Q9BRP4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PAAF1 Rabbit Polyclonal Antibody (orb586633) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_079431
Preservative
Lyophilized powder
AA Sequence
FTVNEINKKSIHISCPKENASSKFLAPYTTFSRIHTKSITCLDISSRGGL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040460-100 1x 100 µL
CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400003-100 1x 100 µL
CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680460-100 1x 100 µL
CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details