PAQR8 Peptide - C-terminal region
PAQR8 Peptide - C-terminal region
Product Specifications
Product Name Alternative
C6orf33, FLJ32521, FLJ46206, LMPB1, MPRB
UniProt
Q8TEZ7
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PAQR8 Rabbit Polyclonal Antibody (orb586634) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_588608
Preservative
Lyophilized powder
AA Sequence
QGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLTKKDS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040226-100 1x 100 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470633-500 1x 500 µL
Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040031-500 1x 500 µL
Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880177-500 1x 500 µL
CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details