Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDIA2 Peptide - N-terminal region

PDIA2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PDA2, PDI, PDIP, PDIR

UniProt

Q13087

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDIA2 Rabbit Polyclonal Antibody (orb586635) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006840

Preservative

Lyophilized powder

AA Sequence

EFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPSAMRLED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4-Dibromobenzoic acid
TRC-D426010-5G 5 g

2,4-Dibromobenzoic acid

Sign In for Pricing
View Details
ANTXR2 Rabbit Polyclonal Antibody
TA373538 100 µL

ANTXR2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL24 Mouse Monoclonal Antibody [Clone ID: OTI4D1]
CF809389 100 µg

IL24 Mouse Monoclonal Antibody [Clone ID: OTI4D1]

Sign In for Pricing
View Details
Human DBC1 (BRINP1) activation kit by CRISPRa
GA101142 1 Kit

Human DBC1 (BRINP1) activation kit by CRISPRa

Sign In for Pricing
View Details
RNF20 Recombinant Rabbit Monoclonal Antibody [SP00-47]
ET1604-4 100 µL

RNF20 Recombinant Rabbit Monoclonal Antibody [SP00-47]

Sign In for Pricing
View Details
Chromogranin A (CHGA/413), CF568 conjugate, 0.1mg/mL
BNC680413-100 1x 100 µL

Chromogranin A (CHGA/413), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details