PPP1R1C Peptide - C-terminal region
PPP1R1C Peptide - C-terminal region
Product Specifications
Product Name Alternative
IPP5
UniProt
Q8WVI7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPP1R1C Rabbit Polyclonal Antibody (orb586637) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001074014
Preservative
Lyophilized powder
AA Sequence
GELQNASPKQRKQSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC742146-500 1x 500 µL
PU.1 (SPI-1) (B-Cell Marker) (PU1/2146), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401841-100 1x 100 µL
Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (rOV-TL12/30), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400142-100 1x 100 µL
Beta-2 Microglobulin (B2M) (BBM.1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681778-500 1x 500 µL
Spectrin beta III (SPTBN2) (SPTBN2/1778), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041797-500 1x 500 µL
Histone H1 (Nuclear Marker) (r1415-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details