Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAP1GAP2 Peptide - N-terminal region

RAP1GAP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686O238, GARNL4, KIAA1039, RAP1GA3

UniProt

Q684P5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAP1GAP2 Rabbit Polyclonal Antibody (orb586638) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055900

Preservative

Lyophilized powder

AA Sequence

MLEKMQGIKLEEQKPGPQKNKDDYIPYPSIDEVVEKGGPYPQVILPQFGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Thrombomodulin/THBD Antibody Picoband®, HRP Conjugate
A01325-3-HRP 100 µg/Vial

Anti-Thrombomodulin/THBD Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
Mouse Forkhead box protein C2 (FOXC2) ELISA Kit
AE61018MO-01 48 Tests

Mouse Forkhead box protein C2 (FOXC2) ELISA Kit

Sign In for Pricing
View Details
Mouse Forkhead box protein C2 (FOXC2) ELISA Kit
AE61018MO-02 96 Tests

Mouse Forkhead box protein C2 (FOXC2) ELISA Kit

Sign In for Pricing
View Details
MLYCD CRISPR/Cas9 KO Plasmid (m)
sc-425254 20 µg

MLYCD CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Rabbit Polyclonal RSK2 Antibody [Alexa Fluor 594]
NBP1-30107AF594 0.1 mL

Rabbit Polyclonal RSK2 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
Mouse Uroplakin-1a, Upk1a ELISA KIT
ELI-16720m 96 Tests

Mouse Uroplakin-1a, Upk1a ELISA KIT

Sign In for Pricing
View Details