Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASEF Peptide - N-terminal region

RASEF Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ31614, RAB45

UniProt

Q8IZ41

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASEF Rabbit Polyclonal Antibody (orb586639) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689786

Preservative

Lyophilized powder

AA Sequence

AQDKAAMQLSELEEEMDQRIQAAEHKTRKDEKRKAEEALSDLRRQYETEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

O2-geranyl uridine
TRC-O144330-5MG 5 mg

O2-geranyl uridine

Sign In for Pricing
View Details
5-Chloro-norlaudanosoline Hydrobromide
TRC-C374865-25MG 25 mg

5-Chloro-norlaudanosoline Hydrobromide

Sign In for Pricing
View Details
(S)-2-[[4-[(3-Fluorobenzyl)oxy]benzyl]amino]propionic acid
TRC-F588690-5MG 5 mg

(S)-2-[[4-[(3-Fluorobenzyl)oxy]benzyl]amino]propionic acid

Sign In for Pricing
View Details
Defluoro-MDV 3100 (Defluoro-enzalutamide)
TRC-D228590-25MG 25 mg

Defluoro-MDV 3100 (Defluoro-enzalutamide)

Sign In for Pricing
View Details
Tissue Total RNA, Liver
CR559544 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details
Map4k1 Mouse Gene Knockout Kit (CRISPR)
KN309744RB 1 Kit

Map4k1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details