Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASEF Peptide - N-terminal region

RASEF Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ31614, RAB45

UniProt

Q8IZ41

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASEF Rabbit Polyclonal Antibody (orb586639) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689786

Preservative

Lyophilized powder

AA Sequence

AQDKAAMQLSELEEEMDQRIQAAEHKTRKDEKRKAEEALSDLRRQYETEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTP cyclohydrolase 1 (GCH1) (NM_000161) Human Over-expression Lysate
LY400058 100 µg

GTP cyclohydrolase 1 (GCH1) (NM_000161) Human Over-expression Lysate

Sign In for Pricing
View Details
CD70 (TNFS7/1026), CF488A conjugate, 0.1mg/mL
BNC881026-500 1x 500 µL

CD70 (TNFS7/1026), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant STAT6 Antibody
RC-16964-01 50 μL

Recombinant STAT6 Antibody

Sign In for Pricing
View Details
Recombinant STAT6 Antibody
RC-16964-02 100 µL

Recombinant STAT6 Antibody

Sign In for Pricing
View Details
Recombinant STAT6 Antibody
RC-16964-03 1 mL

Recombinant STAT6 Antibody

Sign In for Pricing
View Details
AJUBA Human Gene Knockout Kit (CRISPR)
KN205482BN 1 Kit

AJUBA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details