Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REEP3 Peptide - C-terminal region

REEP3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C10orf74

UniProt

Q6NUK4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with REEP3 Rabbit Polyclonal Antibody (orb586641) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001001330

Preservative

Lyophilized powder

AA Sequence

HDLTTIQGDEPVGQRPYQPLPEAKKKSKPAPSESAGYGIPLKDGDEKTDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcein UltraBlue™ sodium salt
21909-AAT 1 mg

Calcein UltraBlue™ sodium salt

Sign In for Pricing
View Details
PDE9A (NM_001001574) Human Recombinant Protein
TP324417L 1 mg

PDE9A (NM_001001574) Human Recombinant Protein

Sign In for Pricing
View Details
3,4-Difluoro-1-nitrobenzene
TRC-D445585-500G 500 g

3,4-Difluoro-1-nitrobenzene

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1758), CF640R conjugate, 0.1mg/mL
BNC401758-100 1x 100 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1758), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sphk1 pSer225 Rabbit Polyclonal Antibody
AP05255PU-N 100 µg

Sphk1 pSer225 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant CSNK2A1 Antibody
RC-5670-01 50 μL

Recombinant CSNK2A1 Antibody

Sign In for Pricing
View Details