Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REEP3 Peptide - C-terminal region

REEP3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C10orf74

UniProt

Q6NUK4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with REEP3 Rabbit Polyclonal Antibody (orb586641) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001001330

Preservative

Lyophilized powder

AA Sequence

HDLTTIQGDEPVGQRPYQPLPEAKKKSKPAPSESAGYGIPLKDGDEKTDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS706315 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Scrn3 Mouse Gene Knockout Kit (CRISPR)
KN515405 1 Kit

Scrn3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Histone H3 (mono methyl K79) Antibody
KC-6226-01 50 μL

Histone H3 (mono methyl K79) Antibody

Sign In for Pricing
View Details
Histone H3 (mono methyl K79) Antibody
KC-6226-02 100 µL

Histone H3 (mono methyl K79) Antibody

Sign In for Pricing
View Details
Histone H3 (mono methyl K79) Antibody
KC-6226-03 1 mL

Histone H3 (mono methyl K79) Antibody

Sign In for Pricing
View Details
ADO Human Gene Knockout Kit (CRISPR)
KN205583RB 1 Kit

ADO Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details