Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIPPLY1 Peptide - middle region

RIPPLY1 Peptide - middle region

Product Specifications

UniProt

Q0D2K3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RIPPLY1 Rabbit Polyclonal Antibody (orb326623) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612391

Preservative

Lyophilized powder

AA Sequence

RPWLSSTNDSPRQMRKLVDLAAGGATAAEVTKAESKFHHPVRLFWPKSRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFEB Antibody / Transcription factor EB
RQ7106 100 µg

TFEB Antibody / Transcription factor EB

Sign In for Pricing
View Details
Puredown Protein G-Agarose, BSA Blocked
P9202-200 20 mL

Puredown Protein G-Agarose, BSA Blocked

Sign In for Pricing
View Details
Recombinant Human LIF Protein
NBP2-34935-500ug 500 µg

Recombinant Human LIF Protein

Sign In for Pricing
View Details
Fam69b sgRNA CRISPR Lentivector (Rat) (Target 2)
K7200403 1.0 µg DNA

Fam69b sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Recombinant Human CNPY1 Protein
E30P70308A 50 µg

Recombinant Human CNPY1 Protein

Sign In for Pricing
View Details
KIRREL3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
25724124 3x 1.0µg DNA

KIRREL3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details