Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRP12 Peptide - C-terminal region

RRP12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp762P1116, FLJ20231, KIAA0690

UniProt

Q5JTH9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RRP12 Rabbit Polyclonal Antibody (orb586643) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055994

Preservative

Lyophilized powder

AA Sequence

AQRVLATQPGPGRGRKKDHGFKVSADGRLIIREEADGNKMEEEEGAKGED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAYN Antibody
KC-505-01 50 μL

LAYN Antibody

Sign In for Pricing
View Details
LAYN Antibody
KC-505-02 100 µL

LAYN Antibody

Sign In for Pricing
View Details
LAYN Antibody
KC-505-03 1 mL

LAYN Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS646971 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
ING2 Human Gene Knockout Kit (CRISPR)
KN402478 1 Kit

ING2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
S100 alpha 6 Recombinant Rabbit monoclonal Antibody
HA750342 100 µL

S100 alpha 6 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details