Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIRPB2 Peptide - middle region

SIRPB2 Peptide - middle region

Product Specifications

Product Name Alternative

PTPN1L, PTPNS1L3, dJ776F14.2

UniProt

E9PCW6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SIRPB2 Rabbit Polyclonal Antibody (orb331359) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001128308

Preservative

Lyophilized powder

AA Sequence

GGISHPKETAVQASNNDFSILLQNVSSEDAGTYYCVKFQRKPNRQYLSGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thrb Mouse Gene Knockout Kit (CRISPR)
KN517541 1 Kit

Thrb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD81 Antibody
KC-610-01 50 μL

CD81 Antibody

Sign In for Pricing
View Details
CD81 Antibody
KC-610-02 100 µL

CD81 Antibody

Sign In for Pricing
View Details
CD81 Antibody
KC-610-03 1 mL

CD81 Antibody

Sign In for Pricing
View Details
1,4-Benzodioxan-2-carbonitrile
TRC-B203510-500MG 500 mg

1,4-Benzodioxan-2-carbonitrile

Sign In for Pricing
View Details
Butachlor (>90%)
TRC-B689925-250MG 250 mg

Butachlor (>90%)

Sign In for Pricing
View Details