SIRPB2 Peptide - middle region
SIRPB2 Peptide - middle region
Product Specifications
Product Name Alternative
PTPN1L, PTPNS1L3, dJ776F14.2
UniProt
E9PCW6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SIRPB2 Rabbit Polyclonal Antibody (orb331359) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001128308
Preservative
Lyophilized powder
AA Sequence
GGISHPKETAVQASNNDFSILLQNVSSEDAGTYYCVKFQRKPNRQYLSGQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471076-100 1x 100 µL
Cytokeratin, HMW (KRTH/1076), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TA592621S 30 µL
hIgG Kappa light chain Specific Rabbit monoclonal antibody, OTIR1G7
Sign In for Pricing
View Details 
BNC401786-100 1x 100 µL
P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC043351-500 1x 500 µL
Fodrin / Alpha Spectrin II (SPTAN1) / NEAS (SPTAN1/3351), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details