Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPEM1 Peptide - N-terminal region

SPEM1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C17orf83, FLJ40081

UniProt

E9PCA5

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPEM1 Rabbit Polyclonal Antibody (orb586651) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_955371

Preservative

Lyophilized powder

AA Sequence

KSSLLRKQTQPPKKQSSPAVHLRCTMDPVMMTVSPPPAHRHRRRGSPTRC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-GSK3α/GSK3A Polyclonal Antibody
PAV7788 100 μL

Rabbit Anti-GSK3α/GSK3A Polyclonal Antibody

Sign In for Pricing
View Details
Aloenin-2-p-coumaroyl ester
M38604-01 100 mg

Aloenin-2-p-coumaroyl ester

Sign In for Pricing
View Details
Aloenin-2-p-coumaroyl ester
M38604-02 25 mg

Aloenin-2-p-coumaroyl ester

Sign In for Pricing
View Details
Aloenin-2-p-coumaroyl ester
M38604-03 50 mg

Aloenin-2-p-coumaroyl ester

Sign In for Pricing
View Details
Aloenin-2-p-coumaroyl ester
M38604-04 500 mg

Aloenin-2-p-coumaroyl ester

Sign In for Pricing
View Details
Aloenin-2-p-coumaroyl ester
M38604-05 Inquire

Aloenin-2-p-coumaroyl ester

Sign In for Pricing
View Details