Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPEM1 Peptide - N-terminal region

SPEM1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C17orf83, FLJ40081

UniProt

E9PCA5

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPEM1 Rabbit Polyclonal Antibody (orb586651) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_955371

Preservative

Lyophilized powder

AA Sequence

KSSLLRKQTQPPKKQSSPAVHLRCTMDPVMMTVSPPPAHRHRRRGSPTRC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Matrix Metalloproteinase 19 ELISA Kit
MBS7263929-01 48 Well

Bovine Matrix Metalloproteinase 19 ELISA Kit

Sign In for Pricing
View Details
Bovine Matrix Metalloproteinase 19 ELISA Kit
MBS7263929-02 96 Well

Bovine Matrix Metalloproteinase 19 ELISA Kit

Sign In for Pricing
View Details
Bovine Matrix Metalloproteinase 19 ELISA Kit
MBS7263929-03 5x 96 Well

Bovine Matrix Metalloproteinase 19 ELISA Kit

Sign In for Pricing
View Details
Bovine Matrix Metalloproteinase 19 ELISA Kit
MBS7263929-04 10x 96 Well

Bovine Matrix Metalloproteinase 19 ELISA Kit

Sign In for Pricing
View Details
5H,6H,7H,8H,9H-Pyrido[3,2-b]indol-9-one
YHA14112-01 100 mg

5H,6H,7H,8H,9H-Pyrido[3,2-b]indol-9-one

Sign In for Pricing
View Details
5H,6H,7H,8H,9H-Pyrido[3,2-b]indol-9-one
YHA14112-02 1 g

5H,6H,7H,8H,9H-Pyrido[3,2-b]indol-9-one

Sign In for Pricing
View Details