Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUCLG2 Peptide - C-terminal region

SUCLG2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

G-BETA, GBETA

UniProt

Q96I99

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SUCLG2 Rabbit Polyclonal Antibody (orb331361) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001171070

Preservative

Lyophilized powder

AA Sequence

AKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGF1, NT (VEGFA, VEGF, Vascular endothelial growth factor A, Vascular permeability factor) (Azide free) (HRP) discontinued
043739-HRP 200 µL

VEGF1, NT (VEGFA, VEGF, Vascular endothelial growth factor A, Vascular permeability factor) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Monkey Fibroblast growth factor 18 ELISA Kit
MBS752796-01 48 Well

Monkey Fibroblast growth factor 18 ELISA Kit

Sign In for Pricing
View Details
Monkey Fibroblast growth factor 18 ELISA Kit
MBS752796-02 96 Well

Monkey Fibroblast growth factor 18 ELISA Kit

Sign In for Pricing
View Details
Monkey Fibroblast growth factor 18 ELISA Kit
MBS752796-03 5x 96 Well

Monkey Fibroblast growth factor 18 ELISA Kit

Sign In for Pricing
View Details
Monkey Fibroblast growth factor 18 ELISA Kit
MBS752796-04 10x 96 Well

Monkey Fibroblast growth factor 18 ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal Cathepsin B Antibody (010) [Allophycocyanin]
NBP2-90402APC 0.1 mL

Rabbit Monoclonal Cathepsin B Antibody (010) [Allophycocyanin]

Sign In for Pricing
View Details