Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMBIM4 Peptide - middle region

TMBIM4 Peptide - middle region

Product Specifications

Product Name Alternative

CGI-119, GAAP, S1R, ZPRO, LFG4

UniProt

Q9HC24

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMBIM4 Rabbit Polyclonal Antibody (orb586654) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057140

Preservative

Lyophilized powder

AA Sequence

LTVAVVVTFYDVYIILQAFILTTTVFFGLTVYTLQSKKDFSKFGAGLFAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Oryza sativa subsp. japonica Probable aquaporin TIP1-1 (TIP1-1)
MBS1034001 Inquire

Recombinant Oryza sativa subsp. japonica Probable aquaporin TIP1-1 (TIP1-1)

Sign In for Pricing
View Details
Recombinant Human GTPase IMAP family member 1 (GIMAP1), partial
MBS1383933-01 0.5 mg (E-Coli)

Recombinant Human GTPase IMAP family member 1 (GIMAP1), partial

Sign In for Pricing
View Details
Recombinant Human GTPase IMAP family member 1 (GIMAP1), partial
MBS1383933-02 0.05 mg (Baculovirus)

Recombinant Human GTPase IMAP family member 1 (GIMAP1), partial

Sign In for Pricing
View Details
Recombinant Human GTPase IMAP family member 1 (GIMAP1), partial
MBS1383933-03 0.5 mg (Yeast)

Recombinant Human GTPase IMAP family member 1 (GIMAP1), partial

Sign In for Pricing
View Details
Recombinant Human GTPase IMAP family member 1 (GIMAP1), partial
MBS1383933-04 0.05 mg (Mammalian-Cell)

Recombinant Human GTPase IMAP family member 1 (GIMAP1), partial

Sign In for Pricing
View Details
Recombinant Human GTPase IMAP family member 1 (GIMAP1), partial
MBS1383933-05 1 mg (E-Coli)

Recombinant Human GTPase IMAP family member 1 (GIMAP1), partial

Sign In for Pricing
View Details