Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMBIM4 Peptide - middle region

TMBIM4 Peptide - middle region

Product Specifications

Product Name Alternative

CGI-119, GAAP, S1R, ZPRO, LFG4

UniProt

Q9HC24

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMBIM4 Rabbit Polyclonal Antibody (orb586654) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057140

Preservative

Lyophilized powder

AA Sequence

LTVAVVVTFYDVYIILQAFILTTTVFFGLTVYTLQSKKDFSKFGAGLFAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31/PECAM-1 (Endothelial Cell Marker)
MBS4380148-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

CD31/PECAM-1 (Endothelial Cell Marker)

Sign In for Pricing
View Details
CD31/PECAM-1 (Endothelial Cell Marker)
MBS4380148-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

CD31/PECAM-1 (Endothelial Cell Marker)

Sign In for Pricing
View Details
CD31/PECAM-1 (Endothelial Cell Marker)
MBS4380148-03 0.1 mg (Without BSA & Azide at 1mg/mL)

CD31/PECAM-1 (Endothelial Cell Marker)

Sign In for Pricing
View Details
CD31/PECAM-1 (Endothelial Cell Marker)
MBS4380148-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)

CD31/PECAM-1 (Endothelial Cell Marker)

Sign In for Pricing
View Details
CD31/PECAM-1 (Endothelial Cell Marker)
MBS4380148-05 5x 0.1 mg (Without BSA & Azide at 1mg/mL)

CD31/PECAM-1 (Endothelial Cell Marker)

Sign In for Pricing
View Details
Defb50 3'UTR Luciferase Stable Cell Line
TU203332 1.0 mL

Defb50 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details